Skip to Content

ELISA Recombinant Xenopus tropicalis LETM1 domain-containing protein LETM2, mitochondrial(letm2)

https://www.anagnostics.com/web/image/product.template/161513/image_1920?unique=871b00d
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) Uniprot NO.:Q28DA8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:NLCPIYTSVSCAQNRAYAPRSSCLVQAAFVSPSWSSRAFHTSGFCLQDAPPSPPPPSTPP SPPEPEKAPQVVRKSLGQRVVDEIKHFYHGFRLLGIDTKVAARMVWRLLHGQVLTRRERR RLMRTCADLFRLVPFMVFVIVPFMEFLLPVFLKLFPEmLPSTFETESKKEEKVKKKLAAK LEMAKFLQETISEMARRNKAETGADTQQQFSSYVQQVRGTGEQPSTKEIVRFSKLFEDEL TLEHLERSQLVALCRLLELPPIGTNNLLRFQLMMQLRSIRADDEMISKEGVENLTVAELQ AASRARGMRSLGLTEEQLKEQMKQWLDLHLKENVPPSLLLLSRALYLTELKPKPILPLKQ AVEIPKINPAVVEAVEAKDNLADTAPTLKGLKGEELVSGTLLKESAVQSKENTKASANGV Protein Names:Recommended name: LETM1 domain-containing protein LETM2, mitochondrial Alternative name(s): LETM1 and EF-hand domain-containing protein 2 Leucine zipper-EF-hand-containing transmembrane protein 1-like Gene Names:Name:letm2 ORF Names:TEgg018g03.1 Expression Region:25-444 Sequence Info:fµLl length protein

1,778.00 € 1778.0 EUR 1,778.00 €

1,778.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.