ELISA Recombinant Rickettsia bellii NADH-quinone oxidoreductase subunit J(nuoJ)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rickettsia bellii (strain RmL369-C) Uniprot NO.:Q1RKE8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MPIFFYLFTTLIIISSLCVVLSKNSVYSVLWLIFAFINGSGLMILLGAEFLAMmLIVIYV GAVAVLFLFVIMmLDMHFNKAIMQLKEKPILSIFVSLIMFADLVVIILLGTKNIHFSSDL SFAIASDVSNTKAIGKILYTDFMIPFQIAGLILFVAMIGCITLTLRKRDGVKRQNIAKQL SHNKENAVLMTKPLINKGIENIKYE Protein Names:Recommended name: NADH-quinone oxidoreductase subunit J EC= 1.6.99.5 Alternative name(s): NADH dehydrogenase I subunit J NDH-1 subunit J Gene Names:Name:nuoJ Ordered Locus Names:RBE_0085 Expression Region:1-205 Sequence Info:fµLl length protein