Skip to Content

ELISA Recombinant Xenopus tropicalis Estradiol 17-beta-dehydrogenase 12(hsd17b12)

https://www.anagnostics.com/web/image/product.template/161496/image_1920?unique=871b00d
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) Uniprot NO.:Q28IU1 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MATESLAEVPVPGCNCFWYLGVVAAVWWGLRAAWCLLDGARVWVLGSGAQVGPRIGKWAV VTGATDGIGKAYAEELAKRGMNIVLISRSPEKLEEVAKQIKEKFKVETKIIAADFGKPTE IYGRIESGLRDLEIGVLVNNVGVSYEHPEYFLEIPDLENTLDKMININITSVCQMTRLVL PGmLGRGRGVILNISSASGMYPVPLLTVYSATKAFVDFFSRGLQAEYRSKGVTVQSVLPF YVATKLAKIRKPTWDKPSPETYVQSALNTVGLQTQTNGYLPHAIMGWISTSLVPVSTAIS LGMKMNKGLRARFLKRAKQK Protein Names:Recommended name: Estradiol 17-beta-dehydrogenase 12 EC= 1.1.1.62 Alternative name(s): 17-beta-hydroxysteroid dehydrogenase 12 Short name= 17-beta-HSD 12 Gene Names:Name:hsd17b12 ORF Names:TNeu053h21.1 Expression Region:1-320 Sequence Info:fµLl length protein

1,673.00 € 1673.0 EUR 1,673.00 €

1,673.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.