ELISA Recombinant Rickettsia bellii Probable cytochrome c oxidase subunit 2(ctaC)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Rickettsia bellii (strain RmL369-C) Uniprot NO.:Q1RI44 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MYFMKNVITLIGLVLFSSFCFASEPLPWQMGFQPPASPIMEELHKFHDFLLYISTAIVLF VAGLLVFVCIKFNARNNPVPAKFSHNILIEIIWTVIPIIILVIIAVPSFRILRHAEKIPE ADLTIKVVGYQWYWHYIYPDHNDIEFDSVMISDENLKPDQKRLLDVDNRIVIPENATVRF LITASDVIHSFAVPSLGFKIDAVPGRVNETWTRVAKKGVYYGQCSELCGINHGFMPIAIE VVSKEDFDNWVASKNKVAANGENSKLAAN Protein Names:Recommended name: Probable cytochrome c oxidase subunit 2 EC= 1.9.3.1 Alternative name(s): Cytochrome aa3 subunit 2 Cytochrome c oxidase polypeptide II Gene Names:Name:ctaC Synonyms:coxB Ordered Locus Names:RBE_0889 Expression Region:1-269 Sequence Info:fµLl length protein