ELISA Recombinant Xenopus tropicalis UPF0708 protein C6orf162 homolog(TEgg033e03.1)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Uniprot NO.:Q28GF4
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSSPSSESSNAKSSPPKEEYRTPGLRGVKTTTLFRAVNPELFIKPNKPVMVFGIVTITMC VAYIAYLHATEENKRELYEAVDSEGNRYTRRKSSKWD
Protein Names:Recommended name: UPF0708 protein C6orf162 homolog
Gene Names:ORF Names:TEgg033e03.1
Expression Region:1-97
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.