ELISA Recombinant Saccharophagus degradans UPF0059 membrane protein Sde_3288(Sde_3288)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Uniprot NO.:Q21FI6
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MIDVVLLALALSMDAFAVSIGLGAKNKASPVVLGLKAALYFGVFQALMPLIGYLGGKGmL GWLASFAPWVAAGLLALIAAKMIYESFAEGIEEDISQLTHRVLLLLAIATSIDALAAGFA LTVLPVAPLVSCALIGVITAIFSFAGVFIGKRAGTWLESKAELAGGLVLLLIALKIIAVA V
Protein Names:Recommended name: UPF0059 membrane protein Sde_3288
Gene Names:Ordered Locus Names:Sde_3288
Expression Region:1-181
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.