Skip to Content

ELISA Recombinant Sheep Prostaglandin F2-alpha receptor(PTGFR)

https://www.anagnostics.com/web/image/product.template/156779/image_1920?unique=263afdf
(0 review)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Ovis aries (Sheep) Uniprot NO.:Q28905 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSTNNSVQPVSPASELLSNTTCQLEEDLSISFSIIFMTVGILSNSLAIAILMKAYQRFRQ KYKSSFLLLASALVITDFFGHLINGTIAVFVYASDKDWIYFDKSNILCSIFGICMVFSGL CPLFLGSLMAIERCIGVTKPIFHSTKITTKHVKMmLSGVCFFAVFVALLPILGHRDYKIQ ASRTWCFYKTDQIKDWEDRFYLLLFAFLGLLALGISFVCNAITGISLLKVKFRSQQHRQG RSHHFEMVIQLLGIMCVSCICWSPFLVTMASIGMNIQDFKDSCERTLFTLRMATWNQILD PWVYILLRKAVLRNLYVCTRRCCGVHVISLHVWELSSIKNSLKVAAISDLPVTEKVTQQT ST Protein Names:Recommended name: Prostaglandin F2-alpha receptor Short name= PGF receptor Short name= PGF2-alpha receptor Alternative name(s): Prostanoid FP receptor Gene Names:Name:PTGFR Expression Region:1-362 Sequence Info:fµLl length protein

1,717.00 € 1717.0 EUR 1,717.00 €

1,717.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.