ELISA Recombinant Xenopus tropicalis Protein YIPF6(yipf6)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) Uniprot NO.:Q28CH8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAETEGFGDSGSKQLFAGLSNVSISGDIPVEGEITVPMASTSQEDDLSTLDEPVKDTIMR DLKAVGNKFLHVMYPKKSTTLLRDWDLWGPLVLCVSLALmLQGGNADSKDDGGPQFAEVF VIIWFGAVVITLNSKLLGGTISFFQSLCVLGYCILPLTVAmLVCRLVLLLSHTTASFIVR LVVVTVMFAWSTFASTAFLADSQPPNRRALAVYPIFLFYFVISWMVLTFNTVS Protein Names:Recommended name: Protein YIPF6 Alternative name(s): YIP1 family member 6 Gene Names:Name:yipf6 ORF Names:TGas105o14.1 Expression Region:1-233 Sequence Info:fµLl length protein