Skip to Content

ELISA Recombinant Vasoactive intestinal polypeptide receptor 1(VIPR1)

https://www.anagnostics.com/web/image/product.template/149737/image_1920?unique=bf930ac
(0 review)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Sus scrofa (Pig) Uniprot NO.:Q28992 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:GLQQEECDYLQMIKVQHKQCLEEAQLENETSGCSKMWDNLTCWPATPRGQVVVLACPLIF KLFSPTQGLNVSRNCTDEGWTPLEPGPYPIACGMDDKASGLDEQQTVFYNSVKTGYTIGY SLSLAALLVATAILSLFRKLHCTRNYIHMHLFISFILRATAVFIKDLALFDSEESDHCSK GSVGCKAAVVLFQYCVMANFFWLLVEGLYLHTLLAVSFFSERKYFWGYIFVGWGVPSTFI MVWTVVRIHFEDYGCWDTIHSSLWWIIKAPILASILVNFILFIRIIGILVQKLRPPDVGK SDNSPYSRLAKSTLLLIPLFGVHYIMFAFFPDNFKAEVKMVFELIVGSFQGCVVAILYCF LNGEVQAELRRKWRRWHQQGVLGWDSKYQHPSGGSNGDTCSTQVSmLTRVSPSARRSSSF QAEVSLV Protein Names:Recommended name: Vasoactive intestinal polypeptide receptor 1 Short name= VIP-R-1 Alternative name(s): Pituitary adenylate cyclase-activating polypeptide type II receptor Short name= PACAP type II receptor Short name= PACAP-R Gene Names:Name:VIPR1 Expression Region:32-458 Sequence Info:fµLl length protein

1,786.00 € 1786.0 EUR 1,786.00 €

1,786.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.