ELISA Recombinant Rhizobium leguminosarum bv. viciae UPF0060 membrane protein RL1530(RL1530)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Rhizobium leguminosarum bv. viciae (strain 3841) Uniprot NO.:Q1MJ35 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTYIIFAFAALFEIAGCFAFWAWLKLENPVWWLAPGMVSLALFAWILTLVPSEAAGRTFA AYGGIYILASLLWLWLVESRVPDRYDIGGALICLAGASLILFAPRG Protein Names:Recommended name: UPF0060 membrane protein RL1530 Gene Names:Ordered Locus Names:RL1530 Expression Region:1-106 Sequence Info:fµLl length protein