ELISA Recombinant Rhizobium leguminosarum bv. viciae Large-conductance mechanosensitive channel(mscL)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Rhizobium leguminosarum bv. viciae (strain 3841) Uniprot NO.:Q1mLQ8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:mLNEFKAFIARGNVMDLAVGVIIGGAFGGIVKSLVDDLIMPIVGAIFGGFDFSNYFLPLS AAVNAQSLAAAREQGAVFAYGSFLTVLINFLILAWIIFLMVKGVNTMRAQIERQEKAAPE ELPPPPADVQLLTEIRDLLARRPTA Protein Names:Recommended name: Large-conductance mechanosensitive channel Gene Names:Name:mscL Ordered Locus Names:RL0602 Expression Region:1-145 Sequence Info:fµLl length protein