ELISA Recombinant Sheep C-X-C chemokine receptor type 4(CXCR4)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Ovis aries (Sheep) Uniprot NO.:Q28553 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:YTEDDLGSGDYDSMKEPCFREENAHFNRIFLPTVYSIIFLTGIVGNGLVILVMGYQKKLR SMTDKYRLHLSVADLLFVLTLPFWAVDAVANWYFGQFLCKAVHVIYTVNLYSSVLILAFI SLDRYLAIVHATNSQRPRKLLAEKVVYVGVWLPAVLLTIPDLIFADIKEADERYICDRFY PSDLWLVVFQFQ Protein Names:Recommended name: C-X-C chemokine receptor type 4 Short name= CXC-R4 Short name= CXCR-4 Alternative name(s): Fusin Leukocyte-derived seven transmembrane domain receptor Short name= LESTR Stromal cell-derived factor 1 r Gene Names:Name:CXCR4 Synonyms:LESTR Expression Region:1-192 Sequence Info:fµLl length protein