ELISA Recombinant Sheep C-X-C chemokine receptor type 4(CXCR4)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Ovis aries (Sheep)
Uniprot NO.:Q28553
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:YTEDDLGSGDYDSMKEPCFREENAHFNRIFLPTVYSIIFLTGIVGNGLVILVMGYQKKLR SMTDKYRLHLSVADLLFVLTLPFWAVDAVANWYFGQFLCKAVHVIYTVNLYSSVLILAFI SLDRYLAIVHATNSQRPRKLLAEKVVYVGVWLPAVLLTIPDLIFADIKEADERYICDRFY PSDLWLVVFQFQ
Protein Names:Recommended name: C-X-C chemokine receptor type 4 Short name= CXC-R4 Short name= CXCR-4 Alternative name(s): Fusin Leukocyte-derived seven transmembrane domain receptor Short name= LESTR Stromal cell-derived factor 1 r
Gene Names:Name:CXCR4 Synonyms:LESTR
Expression Region:1-192
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.