ELISA Recombinant Rabbit CD63 antigen(CD63)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Oryctolagus cunicµLus (Rabbit) Uniprot NO.:Q28709 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:AVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTITHGATPGSLLPVVIIAVG AFLFLVAFVGCCGTCKENYCLMITFAIFLSLImLVEVAAAIAGYVFRDKVMSEFNKDFRQ QMQNYSTDNQTALILDRMQKDFTCCGAANYTDWATIPGMTRDRVPDSCCVNVTSGCGVKF NVKDIYVEGCVEKIGLWLRKNVLVVAAAALGIAFVEVLGIVFACCLVKSIRSGYEVM Protein Names:Recommended name: CD63 antigen Alternative name(s): CD_antigen= CD63 Gene Names:Name:CD63 Expression Region:2-238 Sequence Info:fµLl length protein