ELISA Recombinant Xenopus tropicalis Trimeric intracellular cation channel type B(tmem38b)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) Uniprot NO.:Q28FA9 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MESFSELSLQFSQLSMFPFFETAHYLTSVMSAREQAGAVDVASRSPLASWFSSmLYCFGG GILSSILLAEPPVGILSNTTSIILASAVWYMVYYFPYDLFYNCFFFLPIRLILAGMKEVT RTWKILSGVAHAHSHYKDAmLVMITIGWARGAGGGLISNFEQLVRGVWKPESNEFLKMSY PVKVTLIGAVLFTLQHGQYLPISRHNLMFIYTLFLILIKVTMmLTRSTASPFLPLETSLQ HILFSRQQIPAEVRESPSSSGDKGKPSKKTLDKDSGEQDNKKDN Protein Names:Recommended name: Trimeric intracellµLar cation channel type B Short name= TRIC-B Short name= TRICB Alternative name(s): Transmembrane protein 38B Gene Names:Name:tmem38b ORF Names:TEgg035c21.1 Expression Region:1-284 Sequence Info:fµLl length protein