Skip to Content

ELISA Recombinant Synechococcus sp. ATP synthase subunit b(atpF)

https://www.anagnostics.com/web/image/product.template/159375/image_1920?unique=b3f4f0f
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Synechococcus sp. (strain JA-2-3B'a(2-13)) (Cyanobacteria bacterium Yellowstone B-Prime) Uniprot NO.:Q2JIF8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MPVWSWVAGWILAVAETTELLPEAKAGEGDLLAKILESNLINIAIILTLLFILGRKVVGE ALAKRREGILEELRQAEQRKREAIERLAEEQQKLAQAQQEAERIRKQAEANAEARRQELL EQAEREVERLRANAEKELSSEQERVFQELRRQIVRQALSKVEQELPQHLNEEVHRSLIEK GIQMIAR Protein Names:Recommended name: ATP synthase subunit b Alternative name(s): ATP synthase F(0) sector subunit b ATPase subunit I F-type ATPase subunit b Short name= F-ATPase subunit b Gene Names:Name:atpF Ordered Locus Names:CYB_2675 Expression Region:1-187 Sequence Info:fµLl length protein

1,532.00 € 1532.0 EUR 1,532.00 €

1,532.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.