ELISA Recombinant Syntrophus aciditrophicus ATP synthase subunit b 1(atpF1)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Syntrophus aciditrophicus (strain SB) Uniprot NO.:Q2LQZ9 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MKKSVWHHSLKGYCGRIAAVLCFSVLVPLVAMAAEGGGHGEEGTDWVNFGWRVLDFIILV GLFYWLLASKVKSFFSGRREEIKTTLEEARLAKEAAEHKFKEYSEKLDKASKEIEGVYEM IRAQGQAEKEKILEDARKAAAKMKEDTQARIEQELKKASQQLRMEAVQLSVHVAEDILKR NITPEDHQSMVKDYLDKVVRKH Protein Names:Recommended name: ATP synthase subunit b 1 Alternative name(s): ATP synthase F(0) sector subunit b 1 ATPase subunit I 1 F-type ATPase subunit b 1 Short name= F-ATPase subunit b 1 Gene Names:Name:atpF1 Ordered Locus Names:SYNAS_06280 ORF Names:SYN_00548 Expression Region:1-202 Sequence Info:fµLl length protein