ELISA Recombinant Syntrophus aciditrophicus ATP synthase subunit b 1(atpF1)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Syntrophus aciditrophicus (strain SB)
Uniprot NO.:Q2LQZ9
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MKKSVWHHSLKGYCGRIAAVLCFSVLVPLVAMAAEGGGHGEEGTDWVNFGWRVLDFIILV GLFYWLLASKVKSFFSGRREEIKTTLEEARLAKEAAEHKFKEYSEKLDKASKEIEGVYEM IRAQGQAEKEKILEDARKAAAKMKEDTQARIEQELKKASQQLRMEAVQLSVHVAEDILKR NITPEDHQSMVKDYLDKVVRKH
Protein Names:Recommended name: ATP synthase subunit b 1 Alternative name(s): ATP synthase F(0) sector subunit b 1 ATPase subunit I 1 F-type ATPase subunit b 1 Short name= F-ATPase subunit b 1
Gene Names:Name:atpF1 Ordered Locus Names:SYNAS_06280 ORF Names:SYN_00548
Expression Region:1-202
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.