ELISA Recombinant Staphylococcus aureus UPF0397 protein SAUSA300_2618(SAUSA300_2618)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Staphylococcus aureus (strain USA300) Uniprot NO.:Q2FDH6 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MKKQDISVKTVVAIGIGAAVFVILGRFVVIPTGFPNTNIETSYAFLALISAIFGPFAGLM TGLVGHAIKDFTTYGSAWWSWVICSGIIGCLYGWIGLKLNLSSGRFSRKSMVYFNIGQII ANIICWALIAPTLDILIYNEPANKVYTQGVISAVLNIISVGIIGTILLKAYASSQIKKGS LRKE Protein Names:Recommended name: UPF0397 protein SAUSA300_2618 Gene Names:Ordered Locus Names:SAUSA300_2618 Expression Region:1-184 Sequence Info:fµLl length protein