Skip to Content

ELISA Recombinant Synechococcus sp. Photosystem Q(B) protein 1(psbA1)

https://www.anagnostics.com/web/image/product.template/159522/image_1920?unique=b3f4f0f
(0 review)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Synechococcus sp. (strain JA-3-3Ab) (Cyanobacteria bacterium Yellowstone A-Prime) Uniprot NO.:Q2JTJ2 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTTVIQRRSTSNVWEQFCEWVTSTDNRLYIGWFGVLMIPTLLTATTCFIIAFIGAPPVDI DGIREPVSGSLLYGNNIITGAVVPSSAAIGLHFYPIWEAASLDEWLYNGGPYQLIVLHFL IGVFCYMGREWELSYRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFmLVFQAEHNILMHPFHQLGVAGVFGGALFSAMHGSLVTSSLIRETSEEESQNLGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVIGIWFTALGISIMAFNLNGF NFNQSIVDSNGRVVGTWADVLNRANLGMEVMHERNAHNFPLDLA Protein Names:Recommended name: Photosystem Q(B) protein 1 EC= 1.10.3.9 Alternative name(s): 32 kDa thylakoid membrane protein 1 Photosystem II protein D1 1 Gene Names:Name:psbA1 Ordered Locus Names:CYA_1274 ANDName: psbA4Ordered Locus Names: CYA_1849 Expression Region:1-344 Sequence Info:fµLl length protein

1,698.00 € 1698.0 EUR 1,698.00 €

1,698.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.