ELISA Recombinant Rhizobium etli Energy-coupling factor transporter transmembrane protein BioN(bioN)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Rhizobium etli (strain CFN 42 / ATCC 51251) Uniprot NO.:Q2KBP6 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MQSLYVEGNSRMHRLSPRAKLLSLTAFAILLFISHNLLLLSGAVLVAAVLYGTVGLPIGE ALLRLRPIFLTIAVVALFNLIFNPWQAALVPVLRLTALmLLAASVTATTTITEFIDEVTA LARPLERTGRVQADDIGLALGLVLRFVPEIVNRYQAIREAHKARGLKVRPTSLLAPLIIL TLKDADNVAAAIDARRIRRHGS Protein Names:Recommended name: Energy-coupling factor transporter transmembrane protein BioN Short name= ECF transporter T component BioN Gene Names:Name:bioN Ordered Locus Names:RHE_CH00929 Expression Region:1-202 Sequence Info:fµLl length protein