ELISA Recombinant Synechococcus sp. Protein CrcB homolog(crcB)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Synechococcus sp. (strain JA-2-3B'a(2-13)) (Cyanobacteria bacterium Yellowstone B-Prime) Uniprot NO.:Q2JPX1 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MVSPSLRVPFAVALGAIGGSLSRYYLSLWFAERFGPSFPYGTLIINLSGCVVMGWFMTVA MERPEISPEIRLLFGVGFLGSYTTFSTYELDTFSLWQQHRFATGLVYWLGSCLFGALAME LGILLARLWR Protein Names:Recommended name: Protein CrcB homolog Gene Names:Name:crcB Ordered Locus Names:CYB_0154 Expression Region:1-130 Sequence Info:fµLl length protein