ELISA Recombinant Vulpes vulpes Melanocyte-stimulating hormone receptor(MC1R)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:VµLpes vµLpes (Red fox) Uniprot NO.:Q29154 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSGQGPQRRLLGSPNATSPTTPHFKLAANQTGPRCLEVSIPNGLFLSLGLVSVVENVLVV AAIAKNRNLHSPMYYFIGCLAVSDLLVSVTNVLETAVmLLVEAGALAAQAAVVQQLDDII DVLICGSMVSSLCFLGAIAVDRYLSIFYALRYHSIVTLPRAWRAISAIWVASVLSSTLFI AYYNHTAVLLCLVSFFVAmLVLMAVLYVHmLARARQHARGIARLRKRQHSVHQGFGLKGA ATLTILLGIFFLCWGPFFLHLSLMVLCPQHPICGCVFQNFNLFLTLIICNSIIDPFIYAF RSQELRKTLQEVVLCSW Protein Names:Recommended name: Melanocyte-stimµLating hormone receptor Short name= MSH-R Alternative name(s): Melanocortin receptor 1 Short name= MC1-R Gene Names:Name:MC1R Expression Region:1-317 Sequence Info:fµLl length protein