ELISA Recombinant Synechococcus sp. NAD(P)H-quinone oxidoreductase subunit 4L(ndhE)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Synechococcus sp. (strain JA-3-3Ab) (Cyanobacteria bacterium Yellowstone A-Prime)
Uniprot NO.:Q2JU34
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:mLQLQFFLVVAAILFCIGIYGLIVSRNAIRVLMSIELmLNAVNLNFMAFSNFVDSGLIRG QVFSVFVITVAAAEAAVGLAIVLGIYRNRATIDMESFNLLRW
Protein Names:Recommended name: NAD(P)H-quinone oxidoreductase subunit 4L EC= 1.6.5.- Alternative name(s): NAD(P)H dehydrogenase subunit 4L NADH-plastoquinone oxidoreductase subunit 4L NDH-1, subunit 4L NDH-E
Gene Names:Name:ndhE Ordered Locus Names:CYA_1630
Expression Region:1-102
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.