ELISA Recombinant Synechococcus sp. NAD(P)H-quinone oxidoreductase subunit L(ndhL)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Synechococcus sp. (strain JA-2-3B'a(2-13)) (Cyanobacteria bacterium Yellowstone B-Prime) Uniprot NO.:Q2JJ68 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MASTPSLIGLTYAGLAVLYLLVLPLLSLLYVDKRWTSGSAWEKVLMFFLVLFFFPGMVLL APFMTFRPKPRSL Protein Names:Recommended name: NAD(P)H-quinone oxidoreductase subunit L EC= 1.6.5.- Alternative name(s): NAD(P)H dehydrogenase I subunit L NDH-1 subunit L NDH-L Gene Names:Name:ndhL Ordered Locus Names:CYB_2375 Expression Region:1-73 Sequence Info:fµLl length protein