ELISA Recombinant Rhodospirillum rubrum UPF0059 membrane protein Rru_A0282(Rru_A0282)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rhodospirillum rubrum (strain ATCC 11170 / NCIB 8255) Uniprot NO.:Q2RXQ8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSLATLTVLGFSLSADAFAAALGKGAGARRPDLLEAFRVGAYFGAFEAAAPLIGWALGLT FAARIAAFDHWVAFTLLAGVGGHMVIAALRAPKAETAEASKARQKRALSPLRLALAALAT SIDATAVGIGLAVTEVNILMACALIGAITTVVAAGGVLLGRGAGPLLGRKAEVLGGLALI GIGLKILIEHLSA Protein Names:Recommended name: UPF0059 membrane protein Rru_A0282 Gene Names:Ordered Locus Names:Rru_A0282 Expression Region:1-193 Sequence Info:fµLl length protein