ELISA Recombinant Sodalis glossinidius 4-hydroxybenzoate octaprenyltransferase(ubiA)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Sodalis glossinidius (strain morsitans)
Uniprot NO.:Q2NR07
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MDHSLTQDRWQAWCRLMRIDKPIGSLLLLWPTLWALWLAGMAIPALGTLTVFILGVFFMR AAGCVINDYADRKIDGHVKRTRARPLPSGAIGEKEAKLLFGALVGISFALVLTLNSMTIA LSTVALALAWVYPFMKRYTHLPQLVLGAAFGWSIPMVFTAVSESLPLSCWLLFLANITWT VAYDTQYAMVDRDDDLRIGVKSTAILFGRFDKLIIGLLQLATLLLLGVIGWQLGLGRIYY LALAGAAGLFLWQQKLIVDREREACFRAFLNNNLVGmLIFVGILLSLLSY
Protein Names:Recommended name: 4-hydroxybenzoate octaprenyltransferase EC= 2.5.1.- Alternative name(s): 4-HB polyprenyltransferase
Gene Names:Name:ubiA Ordered Locus Names:SG2143
Expression Region:1-290
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.