ELISA Recombinant Rhodospirillum rubrum ATP synthase subunit b'(atpG)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Rhodospirillum rubrum (strain ATCC 11170 / NCIB 8255) Uniprot NO.:Q2RPA6 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MPQFDPSSFPSQIVWLVIALVAMYFVMSRLAIPRLAEVLEQRQRLINDDLKQAEALKAET EAAIAAYETALAEARARAHDEIRAVTEAAAKAAEARNAEVAKALNTRIKDGEARIVQARD EALTHVREVAGAVASDIVGKLAGLRVDDAALTAAVAAAIKE Protein Names:Recommended name: ATP synthase subunit b' Alternative name(s): ATP synthase F(0) sector subunit b' ATPase subunit II F-type ATPase subunit b' Short name= F-ATPase subunit b' Gene Names:Name:atpG Ordered Locus Names:Rru_A3244 Expression Region:1-161 Sequence Info:fµLl length protein