ELISA Recombinant Xenopus laevis Apelin receptor B(aplnr-b)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Xenopus laevis (African clawed frog) Uniprot NO.:Q2TAD5 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MESEGFSATTEQYEYYDYANETGLQPCDETDWDFSYSLLPVFYMIVFVLGLSGNGVVIFT VWKAKPKRRSADTYIGNLALADLAFVVTLPLWATYTALGFHWPFGSALCKLSSYLVLLNM FASVFCLTCLSFDRYLAIVHSLSSAKLRSRSSILVSLAVIWLFSGLLALPSLILRDTRVE GNNTICDLDFSGVSSKENENFWIGGLSILTTVPGFLLPLLLMTIFYCFIGGKVTMHFQNL KKEEQKKKRLLKIIITLVVVFAICWLPFHILKTIHFLDLMGFLELSCSAQNIIVSLHPYA TCLAYVNSCLNPFLYAFFDLRFRSQCFFFFGFKKVLQGHLSNTSSSLSAQTQKSEIHSLA TKV Protein Names:Recommended name: Apelin receptor B Alternative name(s): Angiotensin receptor-like 1b Angiotensin receptor-related protein B G-protein coupled receptor APJ-B Short name= APJb Gene Names:Name:aplnr-b Synonyms:agtrl1-b, agtrl1b Expression Region:1-363 Sequence Info:fµLl length protein