ELISA Recombinant Staphylococcus aureus UPF0316 protein SAB1848c(SAB1848c)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Staphylococcus aureus (strain bovine RF122 / ET3-1) Uniprot NO.:Q2YU61 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSFVTENPWLMVLTIFIINVCYVTFLTMRTILTLKGYRYIAASVSFLEVLVYIVGLGLVM SNLDHIQNIITYAFGFSIGIIVGMKIEEKLALGYTVVNVTSAEYELDLPNELRNLGYGVT HYAAFGKDGSRMVMQILTPRKYERKLMDTIKNLDPKAFIIAYEPRNIHGGFWTKGIRRRK LKDYEPEELESVVEHEIQSK Protein Names:Recommended name: UPF0316 protein SAB1848c Gene Names:Ordered Locus Names:SAB1848c Expression Region:1-200 Sequence Info:fµLl length protein