ELISA Recombinant Sodalis glossinidius Rhomboid protease glpG(glpG)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Sodalis glossinidius (strain morsitans) Uniprot NO.:Q2NQH3 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MIRVTALSNARLALAFIDYMKTQGVDMELRPQGRYAELWLAQDEKLAQVESALEAFLLDP QHPRYQAASWRTGSLHYRGETGAGLRGWLPALRQQAGPLTLGVTALCVLVFFLMALIGDD RVMAALLYPAGPAQYGQIWRWVSHAFLHFSLLHLLFNVVWWWYLAGLTERYRGRASLAIL FVLSAVVSGMVQSHFSGIFFGGLSGVVYALMGYVWWHGEKNPGGPLFMPLGVIVFALLWL IAGYFNILGIAIANAAHVAGLVTGLLMAFWQTRRGQSHGYQR Protein Names:Recommended name: Rhomboid protease glpG EC= 3.4.21.105 Alternative name(s): Intramembrane serine protease Gene Names:Name:glpG Ordered Locus Names:SG2327 Expression Region:1-282 Sequence Info:fµLl length protein