ELISA Recombinant Rat Putative palmitoyltransferase ZDHHC22(Zdhhc22)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:Q2TGI8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:mLALRLLNVVAPAYFLCISLVTFVLQLFLFLPSMREDPTATPLFSPAVLHGALFLFLSAN ALGNYILVVQNSPDDLGACQGTSSQRPQRPPPSTHFCRVCARVTLRHDHHCFFTGNCIGS RNMRNFILFCLYTSLACLYSMVAGVAYISAVLSISFAHPLAFLTLLPTSISQFFSGAVLG SDMFVILmLYLWFAVGLACAGFCCHQLLLILRGQTRYQVRKGVAVRARPWRKNLQEVFGK RWLLGLLVPMFNVGTESSKQQDK Protein Names:Recommended name: Putative palmitoyltransferase ZDHHC22 EC= 2.3.1.- Alternative name(s): Zinc finger DHHC domain-containing protein 22 Short name= DHHC-22 Gene Names:Name:Zdhhc22 Expression Region:1-263 Sequence Info:fµLl length protein