Skip to Content

ELISA Recombinant Sodalis glossinidius Probable ubiquinone biosynthesis protein UbiB(ubiB)

https://www.anagnostics.com/web/image/product.template/157516/image_1920?unique=263afdf
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Sodalis glossinidius (strain morsitans) Uniprot NO.:Q2NWT9 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MIFGELRRLYLIIGVmLSYGLDELIPKTRLTLPLRLGRNLLFWMPNNHAQRmLGERLRLA LQELGPVWIKFGQmLSTRRDLFPPAIADQLAmLQDRVQPFDGALARAHIERSMGQPLETW FDDFQQEPLASASIAQVHTARLKNGQEVVIKVIRPDILPMIKADMRLMYRLASWVPHLLP DGRRLRPVEVVLEYEKTLLDELNLLREAANAIQLRRNFDGSPmLYIPEVYPDYCSETMMV MERIYGVPVNDVAALEKQGTNMKLLAERGVQVFFTQVFRDSFFHGDMHPGNIFVSFEHPE NPQYIGIDCGIVGSLNKEDKRYLAENFIAFFNRDYRKVAELHVDSGWVPPDTNVEDFEFA IRTVCEPIFEKPLAEISFGHVLLNLFNTARRFNMEVQPQLVLLQKTLLYIEGVGRQLYPQ LDLWKTAKPFLEEWIKDQMGLPAILRALKEKAPYWAEKLPELPELVYDGFKQHRLLQKSV DRLTVEMRVHHVRQSQSRFLFGIGATLLLIGTFLMTQGADEGSLPAWLMAAGTVSWIIGW KRTA Protein Names:Recommended name: Probable ubiquinone biosynthesis protein UbiB Gene Names:Name:ubiB Ordered Locus Names:SG0111 Expression Region:1-544 Sequence Info:fµLl length protein

1,909.00 € 1909.0 EUR 1,909.00 €

1,909.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.