ELISA Recombinant Xanthomonas oryzae pv. oryzae UPF0060 membrane protein XOO1694(XOO1694)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Xanthomonas oryzae pv. oryzae (strain MAFF 311018) Uniprot NO.:Q2P4S8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNLAPTTLLLFAATALAELVGCYLPYLWLRNGGSVWLLLPTALRLASFVWLLSLHPDASG RVYAAYGGVYIASALGLWLWWVDGVTPTRWDLLGAVCCLFGMAIIMFAPRSA Protein Names:Recommended name: UPF0060 membrane protein XOO1694 Gene Names:Ordered Locus Names:XOO1694 Expression Region:1-112 Sequence Info:fµLl length protein