ELISA Recombinant Rhodospirillum rubrum Glycerol-3-phosphate acyltransferase(plsY)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Rhodospirillum rubrum (strain ATCC 11170 / NCIB 8255)
Uniprot NO.:Q2RPF8
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MADLSTLMPALVLGVCALAGYLLGSVPFGLVLVRLAGLGDVRGIGSGNIGATNVLRTGRK DLALATLVLDSGKGAIAALVASALASRIAGFEDAVLAGLLAGGMAVVGHNFPIWLGFKGG KGVATTLGTLLATAWPVGLAACATWLVVAALFRYSSLAALVCLALAPAYALVLATPAHAA VFALLALLAWIRHRANIARLLKGEESRIGAKKKAAP
Protein Names:Recommended name: Glycerol-3-phosphate acyltransferase Alternative name(s): Acyl-PO4 G3P acyltransferase Acyl-phosphate--glycerol-3-phosphate acyltransferase G3P acyltransferase Short name= GPAT EC= 2.3.1.n3 Lysophosphati
Gene Names:Name:plsY Ordered Locus Names:Rru_A3192
Expression Region:1-216
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.