ELISA Recombinant Rhodospirillum rubrum NAD(P) transhydrogenase subunit alpha part 2(pntAB)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Rhodospirillum rubrum (strain ATCC 11170 / NCIB 8255) Uniprot NO.:Q2RSB3 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MEDKNILVEGFNQLSQQALELSQHAQALALQASHAVLPAAAATEGASEFWWLMTVFVLAC FIGFYVVWSVTPALHSPLMGVTNAISSVIVVGALIATGPEAFSASKVLGFFAILLASVNI FGGFIVTQRmLAMFKKKQK Protein Names:Recommended name: NAD(P) transhydrogenase subunit alpha part 2 EC= 1.6.1.2 Alternative name(s): Nicotinamide nucleotide transhydrogenase subunit alpha 2 Proton-translocating transhydrogenase component 2 Pyridine nucleotide transhydr Gene Names:Name:pntAB Synonyms:nntA2 Ordered Locus Names:Rru_A2182 Expression Region:1-139 Sequence Info:fµLl length protein