ELISA Recombinant Rhodospirillum rubrum Undecaprenyl-diphosphatase 2(uppP2)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rhodospirillum rubrum (strain ATCC 11170 / NCIB 8255) Uniprot NO.:Q2RTE2 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MDLVmLIKAAILGLVEGITEFLPISSTGHLIIAGSLLDFLDEQKRDVFVIVIQLGAILAV CWEYRRRLTDVVAGLGSDPQSWKFVTNLLIAFLPAVVLGLTFGKAIKAHLFSPVPVATAF IVGGLVILWAERRRHPIRVREVDEMTWVDALKIGLAQCFALIPGTSRSGATIIGGLFFGL SRKAATEFSFFLAIPTLTAASLYDLYKNRALLDGDMSGLMAVGFVVSFLSALVAVRGLIR YISRHDFTVFAWYRIAFGLVVLATAWSGLVSWSA Protein Names:Recommended name: Undecaprenyl-diphosphatase 2 EC= 3.6.1.27 Alternative name(s): Bacitracin resistance protein 2 Undecaprenyl pyrophosphate phosphatase 2 Gene Names:Name:uppP2 Ordered Locus Names:Rru_A1803 Expression Region:1-274 Sequence Info:fµLl length protein