ELISA Recombinant Xanthomonas phage phiLf Attachment protein G3P(III)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Xanthomonas phage phiLf (Bacteriophage phi-Lf) Uniprot NO.:Q37972 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSPSLFLGWGDDYFVVLWIHGRAVRLGRRQGVGRVIRVSLAmLILLALTFSPIVHATCVQ TEPSTSANNGSWACSDQGEAFAKASSMGVPADLSVCRMKSIRAVSSGPGVFSQRMTYPGD TCGIGYDLDIGTGNATYPDTATCAKRPSQSGWTNPTAPTPSDVCNDGCYYTYAVDAGGPK GYTYVPSGATCTTDDAAPPIDDGGDGDDDGGGDGGGDGGGDGGGDGGGDGGGDGGGDGGG DGGGDGGGDGDGGGDGDGDGDGDGDGEEGGEGAPMSELYKKSGKTVESVLSKFNTQVRGT PMVAGIGDFMKVPSGGSCPVFSLGASKWWDAMTINFHCGGDFLAFLRAAGWVILAIAAYA AIRIAVT Protein Names:Recommended name: Attachment protein G3P Alternative name(s): Gene 3 protein Short name= G3P Minor coat protein Gene Names:Name:III Expression Region:1-367 Sequence Info:fµLl length protein