ELISA Recombinant Shigella boydii serotype 4 UPF0266 membrane protein yobD(yobD)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Shigella boydii serotype 4 (strain Sb227) Uniprot NO.:Q321Z7 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTITDLVLILFIAALLAFAIYDQFIMPRRNGPTLLAIPLLRRGRIDSVIFVGLIVILIYN NVTNHGALITTWLLSALALMGFYIFWIRIPKIIFKQKGFFFANVWIEYSRIKAMNLSEDG VLVMQLEQRRLLIRVRNIDDLEKIYKLLVSGNAANLLI Protein Names:Recommended name: UPF0266 membrane protein yobD Gene Names:Name:yobD Ordered Locus Names:SBO_1232 Expression Region:1-158 Sequence Info:fµLl length protein