ELISA Recombinant Xenopus laevis Elongation of very long chain fatty acids protein 5(elovl5)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Xenopus laevis (African clawed frog)
Uniprot NO.:Q32NI8
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MEVLDKAVNGYIDHLLGPKDPRVKGWLLLDNYVPTIFFTALYLFIVWRGPKYMQNRQPVS CRSILVVYNLGLTLLSFYMFYELVTGVWEGGYNFFCQDTHSGGDADTKIIRVLWWYYFSK LIEFMDTFFFILRKNNHQITVLHVYHHASmLNIWWFVMNWVPCGHSFFGATLNSFIHVLM YSYYGLSAIPAIRPYLWWKKYITQCQLTQFVLTMTQTTCAMIWPCKFPMGWLYFQNSYMI SLIILFTNFYLKTYNKKTSSRRKEYQNGSASAVNGYTNSFSSLEDNVKQRKQRQN
Protein Names:Recommended name: Elongation of very long chain fatty acids protein 5 EC= 2.3.1.n8 Alternative name(s): 3-keto acyl-CoA synthase elovl5 ELOVL fatty acid elongase 5 Short name= ELOVL FA elongase 5
Gene Names:Name:elovl5
Expression Region:1-295
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.