ELISA Recombinant Shigella dysenteriae serotype 1 Prolipoprotein diacylglyceryl transferase(lgt)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Shigella dysenteriae serotype 1 (strain Sd197)
Uniprot NO.:Q32C93
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTSSYLHFPEFDPVIFSIGPVALHWYGLMYLVGFIFAMWLATRRANRPGSGWTKNEVENL LYAGFLGVFLGGRIGYVLFYNFPQFMADPLYLFRVWDGGMSFHGGLIGVIVVMIIFARRT KRSFFQVSDFIAPLIPFGLGAGRLGNFINGELWGRVDPNFPFAmLFPGSRTEDILLLQTN PQWQSIFDTYGVLPRHPSQLYELLLEGVVLFIILNLYIRKPRPMGAVSGLFLIGYGAFRI IVEFFRQPDAQFTGAWVQYISMGQILSIPMIVAGVIMMVWAYRRSPQQHVS
Protein Names:Recommended name: Prolipoprotein diacylglyceryl transferase EC= 2.4.99.-
Gene Names:Name:lgt Ordered Locus Names:SDY_3045
Expression Region:1-291
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.