ELISA Recombinant Trichophyton rubrum ATP synthase subunit a(ATP6)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Trichophyton rubrum (Athlete's foot fungus) (Epidermophyton rubrum) Uniprot NO.:Q36835 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:SPLEQFEIKDLFSLNINIINLKMSLTNFGFYIIISTIIILTLHLLITYNNKLISNSWTLT KESIYATVHSVVINQINSKEGQNYFPFIYGLFIFILMNNLLGLIPYSFSSTSHFILTFFI SFTVVLGATILGFQKHQLKFFSLFVPSGCPLGLLPLLVLIELISYLARNVSLGLRLSANI LSGHmLLVILSDFTFKIMSSGIFYFLIGLIPLAFIFAFSGLELGIAFIQSQVFIVLTCSY IRDSLELH Protein Names:Recommended name: ATP synthase subunit a Alternative name(s): F-ATPase protein 6 Gene Names:Name:ATP6 Expression Region:8-255 Sequence Info:fµLl length protein