Skip to Content

ELISA Recombinant Staphylococcus aureus Probable quinol oxidase subunit 4(qoxD)

https://www.anagnostics.com/web/image/product.template/158194/image_1920?unique=263afdf
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Staphylococcus aureus (strain bovine RF122 / ET3-1) Uniprot NO.:Q2YX17 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSTIMKHTVGFIASIVLTLLAVYVTLYTSLTFHAKLTIIFGFAFVQAGLQLLMFMHLTEG KDGRLQTFKVIFALVITLCFVVGTYWVMQGGHSSHL Protein Names:Recommended name: Probable quinol oxidase subunit 4 EC= 1.10.3.- Alternative name(s): Quinol oxidase polypeptide IV Gene Names:Name:qoxD Ordered Locus Names:SAB0924c Expression Region:1-96 Sequence Info:fµLl length protein

1,436.00 € 1436.0 EUR 1,436.00 €

1,436.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.