Skip to Content

ELISA Recombinant Shigella dysenteriae serotype 1 Potassium-transporting ATPase C chain(kdpC)

https://www.anagnostics.com/web/image/product.template/157250/image_1920?unique=263afdf
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Shigella dysenteriae serotype 1 (strain Sd197) Uniprot NO.:Q32IN4 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSGLRPAISTFIFLLLITGGVYPLLTTVLGQWWFPWQANGSLIREGDTVRGSALIGQNFT DNGYFQGRPSATAEMPYNPQASGGSNLAVSNPELDKQIAARVAALRAANPDTSTSVPAEL VTASASGLDNNITPQAAAWQIPRVAKARNLSVEQLTQLIAKYSQQPLVKYIGQPVVNIVE LNLALDKLDE Protein Names:Recommended name: Potassium-transporting ATPase C chain EC= 3.6.3.12 Alternative name(s): ATP phosphohydrolase [potassium-transporting] C chain Potassium-binding and translocating subunit C Potassium-translocating ATPase C chain Gene Names:Name:kdpC Ordered Locus Names:SDY_0631 Expression Region:1-190 Sequence Info:fµLl length protein

1,536.00 € 1536.0 EUR 1,536.00 €

1,536.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.