ELISA Recombinant Xenopus laevis Sodium-potassium-transporting ATPase subunit beta-1-interacting protein 4(nkain4)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Xenopus laevis (African clawed frog) Uniprot NO.:Q32NX4 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MACCTGRCTLILLCTLQLVAALERQVFDFLGYQWGPILANFLHIVVTILGLFGTLQYRPR YVIAYAIWAAIWVTWNVFLICFYLEVGDLNKESDLLSFHVSQHQSWWSEHGPGCVRKEAP VAGVAGLESHSYVSVIGCSVEYQYIEVMHSALQILLALLGFVYACYVTSVFTEEEDSFDF IGGFDPFPLYHVNEKSNHLLVKQTSLPA Protein Names:Recommended name: Sodium/potassium-transporting ATPase subunit beta-1-interacting protein 4 Short name= Na(+)/K(+)-transporting ATPase subunit beta-1-interacting protein 4 Gene Names:Name:nkain4 Expression Region:1-208 Sequence Info:fµLl length protein