ELISA Recombinant Synechococcus elongatus ATP synthase subunit a(atpB)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Synechococcus elongatus (strain PCC 7942) (Anacystis nidµLans R2) Uniprot NO.:Q31RF6 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MPTLLELSSVLPLAELEVGQHFYWQIGNYRLHGQVFLTSWFVIAALVVLSLLANRNLQRI PSGLQNFMEYVLDFIRNLARTQIGEKEYRPWVPFIGTLFLFIFLSNWSGALIPWKLIKLP SGELAAPTSDINTTVALALLTSLAYFYAGFSRKGLGYFGNYVHPTPVmLPFKILEDFTKP LSLSFRLFGNILADELVVAVLVLLVPLFVPLPAMILGLFTSAIQALIFATLAASYIGEAV EEHGEEHAE Protein Names:Recommended name: ATP synthase subunit a Alternative name(s): ATP synthase F0 sector subunit a F-ATPase subunit 6 Gene Names:Name:atpB Synonyms:atpI Ordered Locus Names:Synpcc7942_0331 Expression Region:1-249 Sequence Info:fµLl length protein