ELISA Recombinant Shigella dysenteriae serotype 1 UPF0056 inner membrane protein marC(marC)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Shigella dysenteriae serotype 1 (strain Sd197) Uniprot NO.:Q32G29 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:mLDLFKAIGLGLVVLLPLANPLTTVALFLGLAGNMNSAERNRQSLMASVYVFAIMMVAYY AGQLVMDTFGISIPGLRIAGGLIVAFIGFRmLFPQQKAIDSPEAKSKSEELEDEPSANIA FVPLAMPSTAGPGTIAMIISSASTVRQSSTFADWVLMVAPPLIFFLVAVILWGSLRSSGA IMRLVGKGGIEAISRLMGFLLVCMGVQFIINGILEIIKTYH Protein Names:Recommended name: UPF0056 inner membrane protein marC Gene Names:Name:marC Ordered Locus Names:SDY_1598 Expression Region:1-221 Sequence Info:fµLl length protein