ELISA Recombinant Shigella dysenteriae serotype 1 UPF0114 protein YqhA(yqhA)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Shigella dysenteriae serotype 1 (strain Sd197) Uniprot NO.:Q32C68 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MERFLENAMYASRWLLAPVYFGLSLALVALALKFFQEIIHVLPNIFSMAESDLILVLLSL VDMTLVGGLLVMVMFSGYENFVSQLDISKNKEKLNWLGKMDATSLKNKVAASIVAISSIH LLRVFMDAKNVPDNKLMWYVIIHLTFVLSAFVMGYLDRLTRHNH Protein Names:Recommended name: UPF0114 protein YqhA Gene Names:Name:yqhA Ordered Locus Names:SDY_3070 Expression Region:1-164 Sequence Info:fµLl length protein