ELISA Recombinant Streptococcus phage Cp-1 Holin(CPH1)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Streptococcus phage Cp-1 (Bacteriophage Cp-1) Uniprot NO.:Q38008 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:mLYNImLEVAKGDYITILFALILFDFITGFLKAWKWKVTDSWTGLKGVIKHTLTFIFYYF VAVFLTYIHAMAVGQILLVIINLYYALSIMENLAVMGVFIPKFMTARVQEELQKYTAQLD AGKDLLEEFKGEKK Protein Names:Recommended name: Holin Alternative name(s): Lysis protein Gene Names:Name:CPH1 Synonyms:21 Expression Region:1-134 Sequence Info:fµLl length protein