ELISA Recombinant Prochlorococcus marinus Protein CrcB homolog 2(crcB2)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Prochlorococcus marinus (strain MIT 9312) Uniprot NO.:Q318A9 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MDITAISLVLFGSTFGLIFRMFIQNNLKINIGFNIQNTSIVNFIASFFLGILLALNLTNN NLLLLFYIGFLGCFSTFSSFIYQLFVLLQKRKFMHLFFHYFEVIIISFICFYLGYYLMQI IK Protein Names:Recommended name: Protein CrcB homolog 2 Gene Names:Name:crcB2 Ordered Locus Names:PMT9312_1726, PMT9312_1725 Expression Region:1-122 Sequence Info:fµLl length protein