ELISA Recombinant Pseudomonas phage Pf1 Head virion protein G6P(VI)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Pseudomonas phage Pf1 (Bacteriophage Pf1) Uniprot NO.:Q38066 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MEWLSGFLDQIIAFFQWIWDFFAQGIYDFVRDGLVVATKASMYAALQTLILLIDVSYTAA RELIDSLGVPQMIRSMYAALPGPIAAGLAFFGVPQALNIIMGRGGDALLHALRAVHWEVI RVDQDPSRPQWLLQNLRRDPG Protein Names:Recommended name: Head virion protein G6P Alternative name(s): Coat protein D G6P Gene Names:Name:VI Expression Region:1-141 Sequence Info:fµLl length protein