Skip to Content

ELISA Recombinant Trypanosoma brucei brucei Phosphatidylinositol:ceramide inositolphosphotransferase(SLS1)

https://www.anagnostics.com/web/image/product.template/160282/image_1920?unique=871b00d
(0 review)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Trypanosoma brucei brucei (strain 927/4 GUTat10.1) Uniprot NO.:Q38E53 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MISYPFFSLSPPGLVPPPMAVPPVEMYSGSFWNRMRKPLPLRTQVIRFTVVFVIVSFILA VALQITHERMPDPKVTKPLPDLGFELLTKISFLSVVTDVLIAFLSSLSFFTLWKLYLLHR HCVGSGEPELPCNIPGVSRFFLSVWLCKENCRIELRNVHTIAWIRFITSYALLLLFRSLV IVMTSMPTPVDKCQNPPKIENPVKNVILTVLTAGGGSIHCGDLMYSGHTVILTLHLMFHW IYGAMVHWSFRPVVTVVAIFGYYCIVASRSHYTDDVLVAIYLTIATFIAVGHNADGAPWQ LQLFIRWLPCCGANSREVTEDSQPVMVAFKSEAVDELRERDDSAGLSCEVSTNEV Protein Names:Recommended name: Phosphatidylinositol:ceramide inositolphosphotransferase EC= 2.7.8.- Alternative name(s): Inositol-phosphorylceramide synthase Short name= IPC synthase Sphingolipid synthase Gene Names:Name:SLS1 ORF Names:Tb09.211.1030 Expression Region:1-355 Sequence Info:fµLl length protein

1,710.00 € 1710.0 EUR 1,710.00 €

1,710.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.